PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004050-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 183aa    MW: 20811.5 Da    PI: 9.9202
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004050-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-32104162159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r  +d+ +v++tYeg H+h+
  NNU_004050-RA 104 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLCKDEGIVVTTYEGMHTHP 162
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-3489162IPR003657WRKY domain
SuperFamilySSF1182901.02E-2996163IPR003657WRKY domain
PROSITE profilePS5081129.68999164IPR003657WRKY domain
SMARTSM007742.8E-38104163IPR003657WRKY domain
PfamPF031061.6E-26105162IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MENYSILFPC SSSSSAAVAV PFSSNMANSR IFADLNDTSP AGFLGLKTET DAHAPRSDVK  60
TLLQNESFGR PKSETKLGIN KKGDQKKIRK PRYAFQTRSQ VDILDDGYRW RKYGQKAVKN  120
NKFPRSYYRC THQGCNVKKQ VQRLCKDEGI VVTTYEGMHT HPIEKSTDNF EHILSQMQIY  180
ASF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-2894163776Probable WRKY transcription factor 4
2lex_A7e-2894163776Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250654.11e-138PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA24e-58WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLA0A061ED356e-82A0A061ED35_THECC; WRKY DNA-binding protein 75
STRINGVIT_14s0068g01770.t013e-77(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-59WRKY DNA-binding protein 75